Lineage for d1x18e1 (1x18 E:7-240)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2858664Superfamily c.23.15: Ribosomal protein S2 [52313] (1 family) (S)
    fold elaborated with additional structures
  5. 2858665Family c.23.15.1: Ribosomal protein S2 [52314] (1 protein)
  6. 2858666Protein Ribosomal protein S2 [52315] (3 species)
  7. 2858703Species Thermus thermophilus [TaxId:274] [52316] (46 PDB entries)
    Uniprot P80371
  8. 2858749Domain d1x18e1: 1x18 E:7-240 [121573]
    Other proteins in same PDB: d1x18f1, d1x18g1, d1x18h1, d1x18x1, d1x18x2
    automatically matched to d1i94b_
    protein/RNA complex

Details for d1x18e1

PDB Entry: 1x18 (more details)

PDB Description: contact sites of era gtpase on the thermus thermophilus 30s subunit
PDB Compounds: (E:) 30S ribosomal protein S2

SCOPe Domain Sequences for d1x18e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x18e1 c.23.15.1 (E:7-240) Ribosomal protein S2 {Thermus thermophilus [TaxId: 274]}
vkelleagvhfgherkrwnpkfaryiyaerngihiidlqktmeelertfrfiedlamrgg
tilfvgtkkqaqdivrmeaeragmpyvnqrwlggmltnfktiqrvhrleelealfaspei
eerpkkeqrlhelerlqkylsgfrllkrlpdaifvvdptkeaiavrearklfipvialad
tdsdpdlvdyiipgnddairsiqlilsravdliiqarggvvepspsyalvq

SCOPe Domain Coordinates for d1x18e1:

Click to download the PDB-style file with coordinates for d1x18e1.
(The format of our PDB-style files is described here.)

Timeline for d1x18e1: