Lineage for d1wzga_ (1wzg A:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1098898Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 1098899Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 1098900Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (4 proteins)
  6. 1098904Protein Heme oxygenase HmuO [89159] (1 species)
  7. 1098905Species Corynebacterium diphtheriae [TaxId:1717] [89160] (12 PDB entries)
    Uniprot P71119
  8. 1098929Domain d1wzga_: 1wzg A: [121501]
    automated match to d1iw1a_
    complexed with gol, so4, yom

Details for d1wzga_

PDB Entry: 1wzg (more details), 1.75 Å

PDB Description: Crystal Structure Of An Artificial Metalloprotein: Fe(Salophen)/Wild Type Heme oxygenase
PDB Compounds: (A:) Heme oxygenase

SCOPe Domain Sequences for d1wzga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wzga_ a.132.1.1 (A:) Heme oxygenase HmuO {Corynebacterium diphtheriae [TaxId: 1717]}
glavelkqstaqahekaehstfmsdllkgrlgvaeftrlqeqawlfytaleqavdavras
gfaeslldpalnraevlardldklngssewrsritaspavidyvnrleeirdnvdgpalv
ahhyvrylgdlsggqviarmmqrhygvdpealgfyhfegiaklkvykdeyreklnnlels
deqrehllkeatdafvfnhqvfadlgkgl

SCOPe Domain Coordinates for d1wzga_:

Click to download the PDB-style file with coordinates for d1wzga_.
(The format of our PDB-style files is described here.)

Timeline for d1wzga_: