Class a: All alpha proteins [46456] (284 folds) |
Fold a.132: Heme oxygenase-like [48612] (1 superfamily) multihelical; bundle |
Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) duplication: contains two structural repeats of 3-helical motif |
Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (4 proteins) |
Protein Heme oxygenase HmuO [89159] (1 species) |
Species Corynebacterium diphtheriae [TaxId:1717] [89160] (12 PDB entries) Uniprot P71119 |
Domain d1wzga_: 1wzg A: [121501] automated match to d1iw1a_ complexed with gol, so4, yom |
PDB Entry: 1wzg (more details), 1.75 Å
SCOPe Domain Sequences for d1wzga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wzga_ a.132.1.1 (A:) Heme oxygenase HmuO {Corynebacterium diphtheriae [TaxId: 1717]} glavelkqstaqahekaehstfmsdllkgrlgvaeftrlqeqawlfytaleqavdavras gfaeslldpalnraevlardldklngssewrsritaspavidyvnrleeirdnvdgpalv ahhyvrylgdlsggqviarmmqrhygvdpealgfyhfegiaklkvykdeyreklnnlels deqrehllkeatdafvfnhqvfadlgkgl
Timeline for d1wzga_: