SCOPe 2.01: Domain d1wzga_: 1wzg A:

Lineage for d1wzga_ (1wzg A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
   multihelical; bundle

4. Superfamily a.132.1: Heme oxygenase-like [48613] (5 families)
   duplication: contains two structural repeats of 3-helical motif

5. Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (4 proteins)

6. Protein Heme oxygenase HmuO [89159] (1 species)

7. Species Corynebacterium diphtheriae [TaxId:1717] [89160] (12 PDB entries)
   Uniprot P71119

8. Domain d1wzga_: 1wzg A: [121501]
   automated match to d1iw1a_
   complexed with gol, so4, yom

Details for d1wzga_

PDB Entry: 1wzg, 1.75 Å

PDB Description: Crystal Structure Of An Artificial Metalloprotein: Fe(Salophen)/Wild Type Heme oxygenase

PDB Compounds: (A:) Heme oxygenase

SCOPe Domain Sequences for d1wzga_:

Sequence; same for both SEQRES and ATOM records:

>d1wzga_ a.132.1.1 (A:) Heme oxygenase HmuO {Corynebacterium diphtheriae [TaxId: 1717]}
glavelkqstaqahekaehstfmsdllkgrlgvaeftrlqeqawlfytaleqavdavras
gfaeslldpalnraevlardldklngssewrsritaspavidyvnrleeirdnvdgpalv
ahhyvrylgdlsggqviarmmqrhygvdpealgfyhfegiaklkvykdeyreklnnlels
deqrehllkeatdafvfnhqvfadlgkgl

Timeline for d1wzga_:

• d1wzga_ first appeared in SCOP 1.73, called d1wzga1
  
• d1wzga_ was called d1wzga1 in SCOP 1.75
  
• d1wzga_ appears in SCOPe 2.02
  
• d1wzga_ appears in the current release, SCOPe 2.08