Lineage for d1ww9a1 (1ww9 A:1-142)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782333Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 2782334Superfamily b.33.1: ISP domain [50022] (4 families) (S)
  5. 2782462Family b.33.1.2: Ring hydroxylating alpha subunit ISP domain [50033] (6 proteins)
  6. 2782535Protein Terminal oxygenase component of carbazole CarAa [141184] (1 species)
  7. 2782536Species Janthinobacterium sp. J3 [TaxId:213804] [141185] (4 PDB entries)
    Uniprot Q84II6 1-142
  8. 2782546Domain d1ww9a1: 1ww9 A:1-142 [121352]
    Other proteins in same PDB: d1ww9a2, d1ww9a3
    complexed with fe2, fes

Details for d1ww9a1

PDB Entry: 1ww9 (more details), 1.95 Å

PDB Description: crystal structure of the terminal oxygenase component of carbazole 1, 9a-dioxygenase, a non-heme iron oxygenase system catalyzing the novel angular dioxygenation for carbazole and dioxin
PDB Compounds: (A:) terminal oxygenase component of carbazole

SCOPe Domain Sequences for d1ww9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ww9a1 b.33.1.2 (A:1-142) Terminal oxygenase component of carbazole CarAa {Janthinobacterium sp. J3 [TaxId: 213804]}
manvdeailkrvkgwapyvdaklgfrnhwypvmfskeinegepktlkllgenllvnridg
klyclkdrclhrgvqlsvkvecktkstitcwyhawtyrwedgvlcdiltnptsaqigrqk
lktypvqeakgcvfiylgdgdp

SCOPe Domain Coordinates for d1ww9a1:

Click to download the PDB-style file with coordinates for d1ww9a1.
(The format of our PDB-style files is described here.)

Timeline for d1ww9a1: