Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins) |
Protein Thioredoxin-like protein Sco1 (YpmQ), soluble domain [102459] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [142371] (2 PDB entries) Uniprot O75880 138-297 |
Domain d1wp0a1: 1wp0 A:138-297 [121132] Other proteins in same PDB: d1wp0b_, d1wp0c_ |
PDB Entry: 1wp0 (more details), 2.8 Å
SCOPe Domain Sequences for d1wp0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wp0a1 c.47.1.10 (A:138-297) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Human (Homo sapiens) [TaxId: 9606]} gpfsltthtgerktdkdylgqwlliyfgfthcpdvcpeelekmiqvvdeidsittlpdlt plfisidperdtkeaianyvkefspklvgltgtreevdqvarayrvyyspgpkdededyi vdhtiimyligpdgefldyfgqnkrkgeiaasiathmrpy
Timeline for d1wp0a1: