Lineage for d1wp0a1 (1wp0 A:138-297)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484063Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2484064Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2485379Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 2485757Protein Thioredoxin-like protein Sco1 (YpmQ), soluble domain [102459] (3 species)
  7. 2485771Species Human (Homo sapiens) [TaxId:9606] [142371] (2 PDB entries)
    Uniprot O75880 138-297
  8. 2485774Domain d1wp0a1: 1wp0 A:138-297 [121132]
    Other proteins in same PDB: d1wp0b_, d1wp0c_

Details for d1wp0a1

PDB Entry: 1wp0 (more details), 2.8 Å

PDB Description: Human SCO1
PDB Compounds: (A:) SCO1 protein homolog

SCOPe Domain Sequences for d1wp0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wp0a1 c.47.1.10 (A:138-297) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Human (Homo sapiens) [TaxId: 9606]}
gpfsltthtgerktdkdylgqwlliyfgfthcpdvcpeelekmiqvvdeidsittlpdlt
plfisidperdtkeaianyvkefspklvgltgtreevdqvarayrvyyspgpkdededyi
vdhtiimyligpdgefldyfgqnkrkgeiaasiathmrpy

SCOPe Domain Coordinates for d1wp0a1:

Click to download the PDB-style file with coordinates for d1wp0a1.
(The format of our PDB-style files is described here.)

Timeline for d1wp0a1: