![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
![]() | Family a.39.1.11: p25-alpha [140538] (2 proteins) Pfam PF05517; comprises two degenerate EF-hands and extra C-terminal helix, packed agains the bundle end |
![]() | Protein Protein cgi-38 [140541] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [140542] (1 PDB entry) Uniprot Q9CRB6 1-138 |
![]() | Domain d1wlma1: 1wlm A:8-145 [121008] Other proteins in same PDB: d1wlma2, d1wlma3 |
PDB Entry: 1wlm (more details)
SCOPe Domain Sequences for d1wlma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wlma1 a.39.1.11 (A:8-145) Protein cgi-38 {Mouse (Mus musculus) [TaxId: 10090]} maastdiagleesfrkfaihgdpkasgqemngknwaklckdckvadgkavtgtdvdivfs kvkaksarvinyeefkkaleelatkrfkgkskeeafdaicqliagkepanigvtkaktgg avdrltdtskytgshker
Timeline for d1wlma1: