Class a: All alpha proteins [46456] (290 folds) |
Fold a.113: DNA repair protein MutS, domain III [48333] (1 superfamily) multihelical; consists of 2 all-alpha subdomains |
Superfamily a.113.1: DNA repair protein MutS, domain III [48334] (2 families) |
Family a.113.1.0: automated matches [254202] (1 protein) not a true family |
Protein automated matches [254442] (1 species) not a true protein |
Species Escherichia coli [TaxId:562] [254939] (3 PDB entries) |
Domain d1wbda1: 1wbd A:270-566 [120841] Other proteins in same PDB: d1wbda2, d1wbda3, d1wbda4, d1wbdb1, d1wbdb3 automated match to d1wb9a1 protein/DNA complex; complexed with adp, mg; mutant |
PDB Entry: 1wbd (more details), 2.4 Å
SCOPe Domain Sequences for d1wbda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wbda1 a.113.1.0 (A:270-566) automated matches {Escherichia coli [TaxId: 562]} daatrrnleitqnlaggaentlasvldctvtpmgsrmlkrwlhmpvrdtrvllerqqtig alqdftaglqpvlrqvgdlerilarlalrtarprdlarmrhafqqlpelraqletvdsap vqalrekmgefaelrdlleraiidtppvlvrdggviasgyneeldewraladgatdyler levrerertgldtlkvgfnavhgyyiqisrgqshlapinymrrqtlknaeryiipelkey edkvltskgkalalekqlyeelfdlllphlealqqsasalaeldvlvnlaeraytln
Timeline for d1wbda1: