Lineage for d1wbda1 (1wbd A:270-566)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338214Fold a.113: DNA repair protein MutS, domain III [48333] (1 superfamily)
    multihelical; consists of 2 all-alpha subdomains
  4. 2338215Superfamily a.113.1: DNA repair protein MutS, domain III [48334] (2 families) (S)
  5. 2338243Family a.113.1.0: automated matches [254202] (1 protein)
    not a true family
  6. 2338244Protein automated matches [254442] (1 species)
    not a true protein
  7. 2338245Species Escherichia coli [TaxId:562] [254939] (3 PDB entries)
  8. 2338246Domain d1wbda1: 1wbd A:270-566 [120841]
    Other proteins in same PDB: d1wbda2, d1wbda3, d1wbda4, d1wbdb1, d1wbdb3
    automated match to d1wb9a1
    protein/DNA complex; complexed with adp, mg; mutant

Details for d1wbda1

PDB Entry: 1wbd (more details), 2.4 Å

PDB Description: crystal structure of e. coli dna mismatch repair enzyme muts, e38q mutant, in complex with a g.t mismatch
PDB Compounds: (A:) DNA mismatch repair protein muts

SCOPe Domain Sequences for d1wbda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wbda1 a.113.1.0 (A:270-566) automated matches {Escherichia coli [TaxId: 562]}
daatrrnleitqnlaggaentlasvldctvtpmgsrmlkrwlhmpvrdtrvllerqqtig
alqdftaglqpvlrqvgdlerilarlalrtarprdlarmrhafqqlpelraqletvdsap
vqalrekmgefaelrdlleraiidtppvlvrdggviasgyneeldewraladgatdyler
levrerertgldtlkvgfnavhgyyiqisrgqshlapinymrrqtlknaeryiipelkey
edkvltskgkalalekqlyeelfdlllphlealqqsasalaeldvlvnlaeraytln

SCOPe Domain Coordinates for d1wbda1:

Click to download the PDB-style file with coordinates for d1wbda1.
(The format of our PDB-style files is described here.)

Timeline for d1wbda1: