Lineage for d1wawa2 (1waw A:267-336)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2185704Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 2186175Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) (S)
  5. 2186176Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)
  6. 2186305Protein Chitotriosidase [82628] (1 species)
  7. 2186306Species Human (Homo sapiens) [TaxId:9606] [82629] (10 PDB entries)
  8. 2186310Domain d1wawa2: 1waw A:267-336 [120823]
    Other proteins in same PDB: d1wawa1
    automatically matched to d1hkia2
    complexed with gol, ipa, so4

Details for d1wawa2

PDB Entry: 1waw (more details), 1.75 Å

PDB Description: specificity and affinity of natural product cyclopentapeptide inhibitor argadin against human chitinase
PDB Compounds: (A:) chitotriosidase 1

SCOPe Domain Sequences for d1wawa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wawa2 d.26.3.1 (A:267-336) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]}
ygrsftlasssdtrvgapatgsgtpgpftkeggmlayyevcswkgatkqriqdqkvpyif
rdnqwvgf

SCOPe Domain Coordinates for d1wawa2:

Click to download the PDB-style file with coordinates for d1wawa2.
(The format of our PDB-style files is described here.)

Timeline for d1wawa2: