PDB entry 1waw

View 1waw on RCSB PDB site
Description: Specificity and affnity of natural product cyclopentapeptide inhibitor Argadin against human chitinase
Class: hydrolase/hydrolase inhibitor
Keywords: human chitinase, argadin, cyclopentapeptide inhibitors, chitinase inhibitors, glycosidase, hydrolase-hydrolase inhibitor complex
Deposited on 2004-10-28, released 2005-01-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-08-05, with a file datestamp of 2015-07-31.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chitotriosidase 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1wawa1, d1wawa2
  • Chain 'B':
    Compound: argadin
    Species: CLONOSTACHYS, synthetic [TaxId:110564]
    Database cross-references and differences (RAF-indexed):
    • PDB 1WAW (0-4)
  • Heterogens: GOL, IPA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wawA (A:)
    aklvcyftnwaqyrqgearflpkdldpslcthliyafagmtnhqlsttewndetlyqefn
    glkkmnpklktllaiggwnfgtqkftdmvatannrqtfvnsairflrkysfdgldldwey
    pgsqgspavdkerfttlvqdlanafqqeaqtsgkerlllsaavpagqtyvdagyevdkia
    qnldfvnlmaydfhgswekvtghnsplykrqeesgaaaslnvdaavqqwlqkgtpaskli
    lgmptygrsftlasssdtrvgapatgsgtpgpftkeggmlayyevcswkgatkqriqdqk
    vpyifrdnqwvgfddvesfktkvsylkqkglggamvwaldlddfagfscnqgrypliqtl
    rqelslpylpsgtpelevpkpgqpsepehgpspgqdtfcqgkadglypnprerssfysca
    agrlfqqscptglvfsnsckcctwn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wawA (A:)
    aklvcyftnwaqyrqgearflpkdldpslcthliyafagmtnhqlsttewndetlyqefn
    glkkmnpklktllaiggwnfgtqkftdmvatannrqtfvnsairflrkysfdgldldwey
    pgsqgspavdkerfttlvqdlanafqqeaqtsgkerlllsaavpagqtyvdagyevdkia
    qnldfvnlmaydfhgswekvtghnsplykrqeesgaaaslnvdaavqqwlqkgtpaskli
    lgmptygrsftlasssdtrvgapatgsgtpgpftkeggmlayyevcswkgatkqriqdqk
    vpyifrdnqwvgfddvesfktkvsylkqkglggamvwaldlddfagfscnqgrypliqtl
    rqelsl
    

  • Chain 'B':
    No sequence available.