SCOPe 2.08: Domain d1w2sb1: 1w2s B:6-69

Lineage for d1w2sb1 (1w2s B:6-69)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
   disulfide-rich all-beta fold

4. Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families)

5. Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins)
   Pfam PF00084

6. Protein Complement receptor 2, cr2 [64564] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [64565] (4 PDB entries)

8. Domain d1w2sb1: 1w2s B:6-69 [120605]
   Other proteins in same PDB: d1w2sa1, d1w2sa2
   automatically matched to d1ly2a1

Details for d1w2sb1

PDB Entry: 1w2s

PDB Description: solution structure of cr2 scr 1-2 in its complex with c3d by x-ray scattering

PDB Compounds: (B:) complement receptor type 2 precursor,

SCOPe Domain Sequences for d1w2sb1:

Sequence; same for both SEQRES and ATOM records:

>d1w2sb1 g.18.1.1 (B:6-69) Complement receptor 2, cr2 {Human (Homo sapiens) [TaxId: 9606]}
scgspppilngrisyystpiavgtviryscsgtfrligeksllcitkdkvdgtwdkpapk
cqyf

Timeline for d1w2sb1:

• d1w2sb1 first appeared in SCOP 1.73
  
• d1w2sb1 appears in SCOPe 2.07