Lineage for d1vsau1 (1vsa U:20-85)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2082731Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 2083045Superfamily b.84.4: Ribosomal L27 protein-like [110324] (3 families) (S)
    rudiment single hybrid fold with a permuted topology
  5. 2083046Family b.84.4.1: Ribosomal L27 protein [110325] (1 protein)
    Pfam PF01016
  6. 2083047Protein Ribosomal protein L27 [110326] (3 species)
  7. 2083086Species Thermus thermophilus [TaxId:274] [110327] (6 PDB entries)
    Uniprot P84123
  8. 2083091Domain d1vsau1: 1vsa U:20-85 [120518]
    Other proteins in same PDB: d1vsaa1, d1vsab1, d1vsac1, d1vsaf1, d1vsaf2, d1vsah1, d1vsai1, d1vsaj1, d1vsal1, d1vsam1, d1vsao1, d1vsap1, d1vsaq1, d1vsar1, d1vsas1, d1vsat1, d1vsaw1, d1vsax1, d1vsaz1
    protein/RNA complex
    protein/RNA complex

Details for d1vsau1

PDB Entry: 1vsa (more details), 3.71 Å

PDB Description: Crystal Structure of a 70S Ribosome-tRNA Complex Reveals Functional Interactions and Rearrangements. This file, 1VSA, contains the 50S ribosome subunit. 30S ribosome subunit is in the file 2OW8
PDB Compounds: (U:) 50S ribosomal protein L27

SCOPe Domain Sequences for d1vsau1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vsau1 b.84.4.1 (U:20-85) Ribosomal protein L27 {Thermus thermophilus [TaxId: 274]}
rlgvkryegqvvragnilvrqrgtrfkpgknvgmgrdftlfalvdgvvefqdrgrlgryv
hvrpla

SCOPe Domain Coordinates for d1vsau1:

Click to download the PDB-style file with coordinates for d1vsau1.
(The format of our PDB-style files is described here.)

Timeline for d1vsau1: