Lineage for d1vsau1 (1vsa U:20-85)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 678222Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 678377Superfamily b.84.4: Ribosomal L27 protein [110324] (1 family) (S)
    rudiment single hybrid fold with a permuted topology
  5. 678378Family b.84.4.1: Ribosomal L27 protein [110325] (1 protein)
    Pfam PF01016
  6. 678379Protein TT0826 [110326] (1 species)
  7. 678380Species Thermus thermophilus [TaxId:274] [110327] (2 PDB entries)
  8. 678385Domain d1vsau1: 1vsa U:20-85 [120518]
    Other proteins in same PDB: d1vsab1, d1vsaw1
    automatically matched to d1v8qa_

Details for d1vsau1

PDB Entry: 1vsa (more details), 3.71 Å

PDB Description: Crystal Structure of a 70S Ribosome-tRNA Complex Reveals Functional Interactions and Rearrangements. This file, 1VSA, contains the 50S ribosome subunit. 30S ribosome subunit is in the file 2OW8
PDB Compounds: (U:) 50S ribosomal protein L27

SCOP Domain Sequences for d1vsau1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vsau1 b.84.4.1 (U:20-85) TT0826 {Thermus thermophilus [TaxId: 274]}
rlgvkryegqvvragnilvrqrgtrfkpgknvgmgrdftlfalvdgvvefqdrgrlgryv
hvrpla

SCOP Domain Coordinates for d1vsau1:

Click to download the PDB-style file with coordinates for d1vsau1.
(The format of our PDB-style files is described here.)

Timeline for d1vsau1: