SCOPe 2.08: Domain d1vfmb2: 1vfm B:503-585

Lineage for d1vfmb2 (1vfm B:503-585)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.0: automated matches [227134] (1 protein)
   not a true family

6. Protein automated matches [226835] (41 species)
   not a true protein

7. Species Thermoactinomyces vulgaris [TaxId:2026] [254921] (8 PDB entries)

8. Domain d1vfmb2: 1vfm B:503-585 [120046]
   Other proteins in same PDB: d1vfma1, d1vfma3, d1vfmb1, d1vfmb3
   automated match to d1wzla2
   complexed with ca

Details for d1vfmb2

PDB Entry: 1vfm, 2.9 Å

PDB Description: crystal structure of thermoactinomyces vulgaris r-47 alpha-amylase 2/alpha-cyclodextrin complex

PDB Compounds: (B:) Neopullulanase 2

SCOPe Domain Sequences for d1vfmb2:

Sequence; same for both SEQRES and ATOM records:

>d1vfmb2 b.71.1.0 (B:503-585) automated matches {Thermoactinomyces vulgaris [TaxId: 2026]}
gnvrswhadkqanlyafvrtvqdqhvgvvlnnrgekqtvllqvpesggktwldcltgeev
hgkqgqlkltlrpyqgmilwngr

Timeline for d1vfmb2:

• d1vfmb2 first appeared in SCOP 1.73
  
• d1vfmb2 appears in SCOPe 2.07