SCOPe 2.01: Domain d1vena1: 1ven A:418-516

Lineage for d1vena1 (1ven A:418-516)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.3: Prealbumin-like [49451] (7 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.1: Starch-binding domain-like [49452] (3 families)

5. Family b.3.1.1: Starch-binding domain [49453] (3 proteins)

6. Protein beta-amylase [49462] (1 species)

7. Species Bacillus cereus [TaxId:1396] [49463] (15 PDB entries)

8. Domain d1vena1: 1ven A:418-516 [120023]
   Other proteins in same PDB: d1vena2
   automatically matched to d1b90a1
   complexed with ca, glc

Details for d1vena1

PDB Entry: 1ven, 2.02 Å

PDB Description: crystal structure analysis of y164e/maltose of bacilus cereus beta- amylase at ph 4.6

PDB Compounds: (A:) beta-amylase

SCOPe Domain Sequences for d1vena1:

Sequence; same for both SEQRES and ATOM records:

>d1vena1 b.3.1.1 (A:418-516) beta-amylase {Bacillus cereus [TaxId: 1396]}
tpvmqtivvknvpttigdtvyitgnraelgswdtkqypiqlyydshsndwrgnvvlpaer
niefkafikskdgtvkswqtiqqswnpvplkttshtssw

Timeline for d1vena1:

• d1vena1 first appeared in SCOP 1.73
  
• d1vena1 appears in SCOP 1.75
  
• d1vena1 appears in SCOPe 2.02
  
• d1vena1 appears in the current release, SCOPe 2.08