Lineage for d1vena1 (1ven A:418-516)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.3: Prealbumin-like [49451] (8 superfamilies)
sandwich; 7 strands in 2 sheets, greek-key
variations: some members have additional 1-2 strands to common fold
Superfamily b.3.1: Starch-binding domain-like [49452] (4 families) 
Family b.3.1.0: automated matches [254199] (1 protein)
not a true familyProtein automated matches [254436] (5 species)
not a true protein- Species Bacillus cereus [TaxId:1396] [254918] (3 PDB entries)
Domain d1vena1: 1ven A:418-516 [120023]
Other proteins in same PDB: d1vena2
automated match to d1vema1
complexed with ca, glc
Details for d1vena1
PDB Entry: 1ven (more details), 2.02 Å
PDB Description: crystal structure analysis of y164e/maltose of bacilus cereus beta- amylase at ph 4.6
PDB Compounds: (A:) beta-amylaseSCOPe Domain Sequences for d1vena1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vena1 b.3.1.0 (A:418-516) automated matches {Bacillus cereus [TaxId: 1396]}
tpvmqtivvknvpttigdtvyitgnraelgswdtkqypiqlyydshsndwrgnvvlpaer
niefkafikskdgtvkswqtiqqswnpvplkttshtssw
SCOPe Domain Coordinates for d1vena1:
Click to download the PDB-style file with coordinates for d1vena1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1vena1:
- d1vena1 first appeared in SCOP 1.73
- d1vena1 appears in SCOPe 2.07
View in 3D
