SCOPe 2.08: Domain d1vb9a2: 1vb9 A:503-585

Lineage for d1vb9a2 (1vb9 A:503-585)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Maltogenic amylase [51031] (4 species)

7. Species Thermoactinomyces vulgaris, TVAII [TaxId:2026] [51033] (12 PDB entries)

8. Domain d1vb9a2: 1vb9 A:503-585 [119946]
   Other proteins in same PDB: d1vb9a1, d1vb9a3, d1vb9b1, d1vb9b3
   automated match to d1jl8a2
   complexed with ca

Details for d1vb9a2

PDB Entry: 1vb9, 2.2 Å

PDB Description: crystal structure of thermoactinomyces vulgaris r-47 alpha-amylase ii (tva ii) complexed with transglycosylated product

PDB Compounds: (A:) alpha-amylase II

SCOPe Domain Sequences for d1vb9a2:

Sequence; same for both SEQRES and ATOM records:

>d1vb9a2 b.71.1.1 (A:503-585) Maltogenic amylase {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]}
gnvrswhadkqanlyafvrtvqdqhvgvvlnnrgekqtvllqvpesggktwldcltgeev
hgkqgqlkltlrpyqgmilwngr

Timeline for d1vb9a2:

• d1vb9a2 first appeared in SCOP 1.73
  
• d1vb9a2 appears in SCOPe 2.07