Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.73: RuBisCO, small subunit [55238] (1 superfamily) alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta |
Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family) |
Family d.73.1.1: RuBisCO, small subunit [55240] (1 protein) |
Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (8 species) |
Species Chlamydomonas reinhardtii [TaxId:3055] [69758] (11 PDB entries) |
Domain d1uwam1: 1uwa M:2-126 [119748] Other proteins in same PDB: d1uwaa1, d1uwaa2, d1uwab1, d1uwab2, d1uwae1, d1uwae2, d1uwah1, d1uwah2, d1uwak1, d1uwak2, d1uwao1, d1uwao2, d1uwar1, d1uwar2, d1uwav1, d1uwav2 automatically matched to d1gk8i_ complexed with cap, edo, mg, pyc; mutant |
PDB Entry: 1uwa (more details), 2.3 Å
SCOP Domain Sequences for d1uwam1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uwam1 d.73.1.1 (M:2-126) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Chlamydomonas reinhardtii [TaxId: 3055]} mvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefaeadkayvsnesairfg svsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimgf lvqrp
Timeline for d1uwam1: