![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family) ![]() C-terminal domain is beta/alpha barrel |
![]() | Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein) |
![]() | Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (12 species) |
![]() | Species Chlamydomonas reinhardtii [TaxId:3055] [69730] (11 PDB entries) |
![]() | Domain d1uwao2: 1uwa O:11-149 [119750] Other proteins in same PDB: d1uwaa1, d1uwab1, d1uwac1, d1uwae1, d1uwaf1, d1uwah1, d1uwai1, d1uwaj1, d1uwak1, d1uwam1, d1uwao1, d1uwap1, d1uwar1, d1uwat1, d1uwav1, d1uwaw1 automatically matched to d1gk8a2 complexed with cap, edo, mg, pyc; mutant |
PDB Entry: 1uwa (more details), 2.3 Å
SCOP Domain Sequences for d1uwao2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uwao2 d.58.9.1 (O:11-149) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Chlamydomonas reinhardtii [TaxId: 3055]} agfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwttvw tdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfkal ralrledlrippayvktfv
Timeline for d1uwao2: