Lineage for d1uwat1 (1uwa T:2-126)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 865003Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 865004Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family) (S)
  5. 865005Family d.73.1.1: RuBisCO, small subunit [55240] (1 protein)
  6. 865006Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (8 species)
  7. 865012Species Chlamydomonas reinhardtii [TaxId:3055] [69758] (11 PDB entries)
  8. 865087Domain d1uwat1: 1uwa T:2-126 [119754]
    Other proteins in same PDB: d1uwaa1, d1uwaa2, d1uwab1, d1uwab2, d1uwae1, d1uwae2, d1uwah1, d1uwah2, d1uwak1, d1uwak2, d1uwao1, d1uwao2, d1uwar1, d1uwar2, d1uwav1, d1uwav2
    automatically matched to d1gk8i_
    complexed with cap, edo, mg, pyc; mutant

Details for d1uwat1

PDB Entry: 1uwa (more details), 2.3 Å

PDB Description: l290f mutant rubisco from chlamydomonas
PDB Compounds: (T:) ribulose bisphosphate carboxylase small chain 1

SCOP Domain Sequences for d1uwat1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uwat1 d.73.1.1 (T:2-126) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Chlamydomonas reinhardtii [TaxId: 3055]}
mvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefaeadkayvsnesairfg
svsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimgf
lvqrp

SCOP Domain Coordinates for d1uwat1:

Click to download the PDB-style file with coordinates for d1uwat1.
(The format of our PDB-style files is described here.)

Timeline for d1uwat1: