Lineage for d1uw9k1 (1uw9 K:150-475)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 814174Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 818439Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (1 family) (S)
  5. 818440Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (1 protein)
    N-terminal domain is alpha+beta
  6. 818441Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [51651] (12 species)
  7. 818466Species Chlamydomonas reinhardtii [TaxId:3055] [69403] (11 PDB entries)
  8. 818499Domain d1uw9k1: 1uw9 K:150-475 [119722]
    Other proteins in same PDB: d1uw9a2, d1uw9b2, d1uw9c1, d1uw9e2, d1uw9f1, d1uw9h2, d1uw9i1, d1uw9j1, d1uw9k2, d1uw9m1, d1uw9o2, d1uw9p1, d1uw9r2, d1uw9t1, d1uw9v2, d1uw9w1
    automatically matched to d1gk8a1
    complexed with cap, edo, mg; mutant

Details for d1uw9k1

PDB Entry: 1uw9 (more details), 2.05 Å

PDB Description: l290f-a222t chlamydomonas rubisco mutant
PDB Compounds: (K:) ribulose bisphosphate carboxylase large chain

SCOP Domain Sequences for d1uw9k1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uw9k1 c.1.14.1 (K:150-475) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Chlamydomonas reinhardtii [TaxId: 3055]}
gpphgiqverdklnkygrgllgctikpklglsaknygravyeclrggldftkddenvnsq
pfmrwrdrflfvteaiykaqaetgevkghylnatagtceemmkravcakelgvpiimhdy
ltggftantslaiycrdnglflhihramhavidrqrnhgihfrvlakalrmsggdhlhsg
tvvgklegerevtlgfvdlmrddyvekdrsrgiyftqdwcsmpgvmpvasggihvwhmpa
lveifgddaclqfgggtlghpwgnapgaaanrvaleactqarnegrdlareggdvirsac
kwspelaaacevwkeikfefdtidkl

SCOP Domain Coordinates for d1uw9k1:

Click to download the PDB-style file with coordinates for d1uw9k1.
(The format of our PDB-style files is described here.)

Timeline for d1uw9k1: