SCOP 1.75: Domain d1uw9h2: 1uw9 H:11-149

Lineage for d1uw9h2 (1uw9 H:11-149)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family)
   C-terminal domain is beta/alpha barrel

5. Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)

6. Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (12 species)

7. Species Chlamydomonas reinhardtii [TaxId:3055] [69730] (11 PDB entries)

8. Domain d1uw9h2: 1uw9 H:11-149 [119719]
   Other proteins in same PDB: d1uw9a1, d1uw9b1, d1uw9c1, d1uw9e1, d1uw9f1, d1uw9h1, d1uw9i1, d1uw9j1, d1uw9k1, d1uw9m1, d1uw9o1, d1uw9p1, d1uw9r1, d1uw9t1, d1uw9v1, d1uw9w1
   automatically matched to d1gk8a2
   complexed with cap, edo, mg; mutant

Details for d1uw9h2

PDB Entry: 1uw9, 2.05 Å

PDB Description: l290f-a222t chlamydomonas rubisco mutant

PDB Compounds: (H:) ribulose bisphosphate carboxylase large chain

SCOP Domain Sequences for d1uw9h2:

Sequence; same for both SEQRES and ATOM records:

>d1uw9h2 d.58.9.1 (H:11-149) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Chlamydomonas reinhardtii [TaxId: 3055]}
agfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwttvw
tdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfkal
ralrledlrippayvktfv

Timeline for d1uw9h2:

• d1uw9h2 first appeared in SCOP 1.73
  
• d1uw9h2 appears in SCOPe 2.01
  
• d1uw9h2 appears in the current release, SCOPe 2.08