Lineage for d1uw9f1 (1uw9 F:2-126)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 865003Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 865004Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family) (S)
  5. 865005Family d.73.1.1: RuBisCO, small subunit [55240] (1 protein)
  6. 865006Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (8 species)
  7. 865012Species Chlamydomonas reinhardtii [TaxId:3055] [69758] (11 PDB entries)
  8. 865042Domain d1uw9f1: 1uw9 F:2-126 [119717]
    Other proteins in same PDB: d1uw9a1, d1uw9a2, d1uw9b1, d1uw9b2, d1uw9e1, d1uw9e2, d1uw9h1, d1uw9h2, d1uw9k1, d1uw9k2, d1uw9o1, d1uw9o2, d1uw9r1, d1uw9r2, d1uw9v1, d1uw9v2
    automatically matched to d1gk8i_
    complexed with cap, edo, mg; mutant

Details for d1uw9f1

PDB Entry: 1uw9 (more details), 2.05 Å

PDB Description: l290f-a222t chlamydomonas rubisco mutant
PDB Compounds: (F:) ribulose bisphosphate carboxylase small chain 1

SCOP Domain Sequences for d1uw9f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uw9f1 d.73.1.1 (F:2-126) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Chlamydomonas reinhardtii [TaxId: 3055]}
mvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefaeadkayvsnesairfg
svsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimgf
lvqrp

SCOP Domain Coordinates for d1uw9f1:

Click to download the PDB-style file with coordinates for d1uw9f1.
(The format of our PDB-style files is described here.)

Timeline for d1uw9f1: