Lineage for d1u3hc1 (1u3h C:82-181)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1290587Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1291899Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)
  7. 1291965Species Mouse (Mus musculus), I-A group [TaxId:10090] [88624] (24 PDB entries)
    probably orthologous to the human HLA-DQ group
  8. 1291974Domain d1u3hc1: 1u3h C:82-181 [119510]
    Other proteins in same PDB: d1u3ha1, d1u3hb1, d1u3hc2, d1u3hd1, d1u3hd2, d1u3he_, d1u3hf_, d1u3hg2, d1u3hh1, d1u3hh2
    automatically matched to d1k2da1

Details for d1u3hc1

PDB Entry: 1u3h (more details), 2.42 Å

PDB Description: crystal structure of mouse tcr 172.10 complexed with mhc class ii i-au molecule at 2.4 a
PDB Compounds: (C:) H-2 class II histocompatibility antigen, A-U alpha chain

SCOPe Domain Sequences for d1u3hc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u3hc1 b.1.1.2 (C:82-181) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]}
atneapqatvfpkspvllgqpntlicfvdnifppvinitwlrnsksvadgvyetsffvnr
dysfhklsyltfipsdddiydckvehwgleepvlkhwepe

SCOPe Domain Coordinates for d1u3hc1:

Click to download the PDB-style file with coordinates for d1u3hc1.
(The format of our PDB-style files is described here.)

Timeline for d1u3hc1: