Lineage for d1tp3a1 (1tp3 A:302-403)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1785878Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 1785879Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 1785880Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 1786103Protein Synaptic protein PSD-95 [50162] (2 species)
    Synonym: synapse associated protein 90, sap90
    duplication: contains three PDZ domains
  7. 1786106Species Norway rat (Rattus norvegicus) [TaxId:10116] [50163] (8 PDB entries)
    Uniprot P31016 62-154
  8. 1786109Domain d1tp3a1: 1tp3 A:302-403 [119304]

Details for d1tp3a1

PDB Entry: 1tp3 (more details), 1.99 Å

PDB Description: pdz3 domain of psd-95 protein complexed with kketpv peptide ligand
PDB Compounds: (A:) Presynaptic density protein 95

SCOPe Domain Sequences for d1tp3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tp3a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
lgeedipreprrivihrgstglgfnivggedgegifisfilaggpadlsgelrkgdqils
vngvdlrnasheqaaialknagqtvtiiaqykpeeysrfean

SCOPe Domain Coordinates for d1tp3a1:

Click to download the PDB-style file with coordinates for d1tp3a1.
(The format of our PDB-style files is described here.)

Timeline for d1tp3a1: