PDB entry 1tp3

View 1tp3 on RCSB PDB site
Description: PDZ3 domain of PSD-95 protein complexed with KKETPV peptide ligand
Class: protein binding
Keywords: PDZ domain, PROTEIN BINDING
Deposited on 2004-06-15, released 2005-09-20
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: 0.228
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Presynaptic density protein 95
  Species: Rattus norvegicus [TaxId:10116]
  Gene: DLG4, DLGH4, PSD95
  Database cross-references and differences (RAF-indexed):
  • Uniprot P31016 (5-105)
    • cloning artifact (4)
    • cloning artifact (106-118)
  Domains in SCOPe 2.05: d1tp3a1
• Chain 'B':
  Compound: KKETPV peptide ligand
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • PDB 1TP3 (0-5)
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1tp3A (A:)
  gspeflgeedipreprrivihrgstglgfnivggedgegifisfilaggpadlsgelrkg
  dqilsvngvdlrnasheqaaialknagqtvtiiaqykpeeysrfeansrvdssgrivtd
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1tp3A (A:)
  flgeedipreprrivihrgstglgfnivggedgegifisfilaggpadlsgelrkgdqil
  svngvdlrnasheqaaialknagqtvtiiaqykpeeysrfeansrvdssgrivtd
  

  
  
• Chain 'B':
  No sequence available.