Lineage for d1sqpc1 (1sqp C:261-379)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2633244Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily)
    core: three transmembrane helices, up-and-down bundle
  4. 2633245Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (2 families) (S)
  5. 2633246Family f.32.1.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81647] (3 proteins)
    a part (domain) of mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria
  6. 2633247Protein Mitochondrial cytochrome b subunit, C-terminal domain [81646] (3 species)
  7. 2633269Species Cow (Bos taurus) [TaxId:9913] [81643] (19 PDB entries)
    Uniprot P00157
  8. 2633288Domain d1sqpc1: 1sqp C:261-379 [118999]
    Other proteins in same PDB: d1sqpa1, d1sqpa2, d1sqpb1, d1sqpb2, d1sqpc2, d1sqpd1, d1sqpd2, d1sqpe1, d1sqpe2, d1sqpf1, d1sqpg_, d1sqph_, d1sqpi_, d1sqpj_, d1sqpk1
    automated match to d1ntmc1
    complexed with cdl, fes, hem, myx, pee, plx

Details for d1sqpc1

PDB Entry: 1sqp (more details), 2.7 Å

PDB Description: crystal structure analysis of bovine bc1 with myxothiazol
PDB Compounds: (C:) cytochrome b

SCOPe Domain Sequences for d1sqpc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqpc1 f.32.1.1 (C:261-379) Mitochondrial cytochrome b subunit, C-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
plntpphikpewyflfayailrsipnklggvlalafsililalipllhtskqrsmmfrpl
sqclfwalvadlltltwiggqpvehpyitigqlasvlyfllilvlmptagtienkllkw

SCOPe Domain Coordinates for d1sqpc1:

Click to download the PDB-style file with coordinates for d1sqpc1.
(The format of our PDB-style files is described here.)

Timeline for d1sqpc1: