![]() | Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
![]() | Fold f.28: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81532] (1 superfamily) membrane-associated alpha-helical protein; no transmembrane helices |
![]() | Superfamily f.28.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81531] (1 family) ![]() location - intermembrane side of the bc1 complex automatically mapped to Pfam PF02320 |
![]() | Family f.28.1.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81530] (2 proteins) "acidic/hinge protein", essential for the complex formation, interacts with the functional domain of cytochrome c1 |
![]() | Protein automated matches [190042] (4 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [186764] (7 PDB entries) |
![]() | Domain d1sqph_: 1sqp H: [119004] Other proteins in same PDB: d1sqpa1, d1sqpa2, d1sqpb1, d1sqpb2, d1sqpc1, d1sqpc2, d1sqpd1, d1sqpd2, d1sqpe1, d1sqpe2, d1sqpf1, d1sqpg_, d1sqpi_, d1sqpj_, d1sqpk1 automated match to d1l0lh_ complexed with cdl, fes, hem, myx, pee, plx |
PDB Entry: 1sqp (more details), 2.7 Å
SCOPe Domain Sequences for d1sqph_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sqph_ f.28.1.1 (H:) automated matches {Cow (Bos taurus) [TaxId: 9913]} elvdplttvreqceqlekcvkarerlelcdervssrsqteedcteelldflhardhcvah klfnslk
Timeline for d1sqph_: