Lineage for d1sqpa1 (1sqp A:1-233)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2611057Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
    core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta
  4. 2611058Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families) (S)
    Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues
  5. 2611059Family d.185.1.1: MPP-like [63412] (7 proteins)
    Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal
  6. 2611060Protein Cytochrome bc1 core subunit 1 [63408] (3 species)
  7. 2611089Species Cow (Bos taurus) [TaxId:9913] [55997] (19 PDB entries)
    Uniprot P31800
  8. 2611126Domain d1sqpa1: 1sqp A:1-233 [118995]
    Other proteins in same PDB: d1sqpb1, d1sqpb2, d1sqpc1, d1sqpc2, d1sqpd1, d1sqpd2, d1sqpe1, d1sqpe2, d1sqpf1, d1sqpg_, d1sqph_, d1sqpi_, d1sqpj_, d1sqpk1
    automated match to d1sqba1
    complexed with cdl, fes, hem, myx, pee, plx

Details for d1sqpa1

PDB Entry: 1sqp (more details), 2.7 Å

PDB Description: crystal structure analysis of bovine bc1 with myxothiazol
PDB Compounds: (A:) Ubiquinol-cytochrome-c reductase complex core protein I, mitochondrial precursor

SCOPe Domain Sequences for d1sqpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sqpa1 d.185.1.1 (A:1-233) Cytochrome bc1 core subunit 1 {Cow (Bos taurus) [TaxId: 9913]}
tatyaqalqsvpetqvsqldnglrvaseqssqptctvgvwidagsryeseknngagyfve
hlafkgtknrpgnalekevesmgahlnaystrehtayyikalskdlpkavelladivqnc
sledsqiekerdvilqelqendtsmrdvvfnylhatafqgtplaqsvegpsenvrklsra
dlteylsrhykaprmvlaaagglehrqlldlaqkhfsglsgtydedavptlsp

SCOPe Domain Coordinates for d1sqpa1:

Click to download the PDB-style file with coordinates for d1sqpa1.
(The format of our PDB-style files is described here.)

Timeline for d1sqpa1: