Lineage for d1pkuk_ (1pku K:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1413688Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1415050Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 1415051Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)
  6. 1415295Protein automated matches [190032] (11 species)
    not a true protein
  7. 1415434Species Rice (Oryza sativa) [TaxId:4530] [186751] (1 PDB entry)
  8. 1415444Domain d1pkuk_: 1pku K: [118728]
    Other proteins in same PDB: d1pkua1
    automated match to d1u8wa_

Details for d1pkuk_

PDB Entry: 1pku (more details), 2.5 Å

PDB Description: Crystal Structure of Nucleoside Diphosphate Kinase from Rice
PDB Compounds: (K:) Nucleoside Diphosphate Kinase I

SCOPe Domain Sequences for d1pkuk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pkuk_ d.58.6.1 (K:) automated matches {Rice (Oryza sativa) [TaxId: 4530]}
rmeqsfimikpdgvqrgligdiisrfekkgfylrgmkfmnversfaqqhyadlsdkpffp
glveyiisgpvvamvwegkdvvatgrriigatrpweaapgtiradyavevgrnvihgsds
vdngkkeialwfpeglaewrsnlhpwiye

SCOPe Domain Coordinates for d1pkuk_:

Click to download the PDB-style file with coordinates for d1pkuk_.
(The format of our PDB-style files is described here.)

Timeline for d1pkuk_: