Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) |
Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins) |
Protein automated matches [190032] (11 species) not a true protein |
Species Rice (Oryza sativa) [TaxId:4530] [186751] (1 PDB entry) |
Domain d1pkud_: 1pku D: [118721] Other proteins in same PDB: d1pkua1 automated match to d1u8wa_ |
PDB Entry: 1pku (more details), 2.5 Å
SCOPe Domain Sequences for d1pkud_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pkud_ d.58.6.1 (D:) automated matches {Rice (Oryza sativa) [TaxId: 4530]} rmeqsfimikpdgvqrgligdiisrfekkgfylrgmkfmnversfaqqhyadlsdkpffp glveyiisgpvvamvwegkdvvatgrriigatrpweaapgtiradyavevgrnvihgsds vdngkkeialwfpeglaewrsnlhpwiye
Timeline for d1pkud_: