SCOPe 2.01: Domain d1pk3a1: 1pk3 A:17-79

Lineage for d1pk3a1 (1pk3 A:17-79)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.1: SAM/Pointed domain [47769] (4 families)

5. Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (16 proteins)

6. Protein Polycomb protein Scm [140620] (1 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [140621] (2 PDB entries)
   Uniprot Q9VHA0 795-871

8. Domain d1pk3a1: 1pk3 A:17-79 [118715]
   Other proteins in same PDB: d1pk3b_, d1pk3c_
   complexed with bme

Details for d1pk3a1

PDB Entry: 1pk3, 1.85 Å

PDB Description: scm sam domain

PDB Compounds: (A:) Sex comb on midleg CG9495-PA

SCOPe Domain Sequences for d1pk3a1:

Sequence; same for both SEQRES and ATOM records:

>d1pk3a1 a.60.1.2 (A:17-79) Polycomb protein Scm {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
wtieeviqyiesndnslavhgdlfrkheidgkallrlnsemmmkymglklgpalkicnlv
nkv

Timeline for d1pk3a1:

• d1pk3a1 first appeared in SCOP 1.73
  
• d1pk3a1 appears in SCOP 1.75
  
• d1pk3a1 appears in SCOPe 2.02
  
• d1pk3a1 appears in the current release, SCOPe 2.08