SCOPe 2.01: Domain d1pk3c_: 1pk3 C:

Lineage for d1pk3c_ (1pk3 C:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.1: SAM/Pointed domain [47769] (4 families)

5. Family a.60.1.0: automated matches [191306] (1 protein)
   not a true family

6. Protein automated matches [190031] (2 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [186750] (2 PDB entries)

8. Domain d1pk3c_: 1pk3 C: [118717]
   Other proteins in same PDB: d1pk3a1
   automated match to d1kw4a_
   complexed with bme

Details for d1pk3c_

PDB Entry: 1pk3, 1.85 Å

PDB Description: scm sam domain

PDB Compounds: (C:) Sex comb on midleg CG9495-PA

SCOPe Domain Sequences for d1pk3c_:

Sequence; same for both SEQRES and ATOM records:

>d1pk3c_ a.60.1.0 (C:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
ktranshlrsqpidwtieeviqyiesndnslavhgdlfrkheidgkallrlnsemmmkym
glklgpalkicnlvnkvn

Timeline for d1pk3c_:

• d1pk3c_ first appeared in SCOP 1.73, called d1pk3c1
  
• d1pk3c_ was called d1pk3c1 in SCOP 1.75
  
• d1pk3c_ appears in SCOPe 2.02
  
• d1pk3c_ appears in the current release, SCOPe 2.08, called d1pk3c2