Lineage for d4cpaj_ (4cpa J:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2257050Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2257256Superfamily g.3.2: Plant inhibitors of proteinases and amylases [57027] (1 family) (S)
  5. 2257257Family g.3.2.1: Plant inhibitors of proteinases and amylases [57028] (4 proteins)
  6. 2257263Protein Carboxypeptidase A inhibitor [57034] (1 species)
  7. 2257264Species Potato [TaxId:4113] [57035] (2 PDB entries)
  8. 2257266Domain d4cpaj_: 4cpa J: [118683]
    Other proteins in same PDB: d4cpaa_, d4cpab_
    duplicate of 4CPA I
    complexed with gly, zn

Details for d4cpaj_

PDB Entry: 4cpa (more details), 2.5 Å

PDB Description: refined crystal structure of the potato inhibitor complex of carboxypeptidase a at 2.5 angstroms resolution
PDB Compounds: (J:) Metallocarboxypeptidase inhibitor

SCOPe Domain Sequences for d4cpaj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cpaj_ g.3.2.1 (J:) Carboxypeptidase A inhibitor {Potato [TaxId: 4113]}
zhadpicnkpckthddcsgawfcqacwnsartcgpyv

SCOPe Domain Coordinates for d4cpaj_:

Click to download the PDB-style file with coordinates for d4cpaj_.
(The format of our PDB-style files is described here.)

Timeline for d4cpaj_: