Class g: Small proteins [56992] (100 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.2: Plant inhibitors of proteinases and amylases [57027] (1 family) |
Family g.3.2.1: Plant inhibitors of proteinases and amylases [57028] (4 proteins) |
Protein Carboxypeptidase A inhibitor [57034] (1 species) |
Species Potato [TaxId:4113] [57035] (2 PDB entries) |
Domain d4cpaj_: 4cpa J: [118683] Other proteins in same PDB: d4cpaa_, d4cpab_ duplicate of 4CPA I complexed with gly, zn |
PDB Entry: 4cpa (more details), 2.5 Å
SCOPe Domain Sequences for d4cpaj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cpaj_ g.3.2.1 (J:) Carboxypeptidase A inhibitor {Potato [TaxId: 4113]} zhadpicnkpckthddcsgawfcqacwnsartcgpyv
Timeline for d4cpaj_: