SCOPe 2.05: Domain d3sody_: 3sod Y:

Lineage for d3sody_ (3sod Y:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families)
   has additional strand at N-terminus

5. Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)

6. Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species)

7. Species Cow (Bos taurus) [TaxId:9913] [49332] (23 PDB entries)

8. Domain d3sody_: 3sod Y: [118681]
   complexed with cu, zn; mutant

Details for d3sody_

PDB Entry: 3sod, 2.1 Å

PDB Description: changes in crystallographic structure and thermostability of a cu,zn superoxide dismutase mutant resulting from the removal of buried cysteine

PDB Compounds: (Y:) Copper,Zinc Superoxide Dismutase

SCOPe Domain Sequences for d3sody_:

Sequence; same for both SEQRES and ATOM records:

>d3sody_ b.1.8.1 (Y:) Cu,Zn superoxide dismutase, SOD {Cow (Bos taurus) [TaxId: 9913]}
atkavavlkgdgpvqgtihfeakgdtvvvtgsitgltegdhgfhvhqfgdntqgctsagp
hfnplskkhggpkdeerhvgdlgnvtadkngvaivdivdplislsgeysiigrtmvvhek
pddlgrggneestktgnagsrlacgvigiak

Timeline for d3sody_:

• d3sody_ first appeared in SCOP 1.73
  
• d3sody_ appears in SCOPe 2.04
  
• d3sody_ appears in SCOPe 2.06
  
• d3sody_ appears in the current release, SCOPe 2.08