SCOPe 2.06: Domain d1fdhh_: 1fdh H:

Lineage for d1fdhh_ (1fdh H:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin, beta-chain [46500] (25 species)

7. Species Human fetus (Homo sapiens), gamma-chain [TaxId:9606] [46502] (3 PDB entries)

8. Domain d1fdhh_: 1fdh H: [118455]
   Other proteins in same PDB: d1fdha_, d1fdhb_
   complexed with hem

Details for d1fdhh_

PDB Entry: 1fdh, 2.5 Å

PDB Description: structure of human foetal deoxyhaemoglobin

PDB Compounds: (H:) hemoglobin f (deoxy) (gamma chain)

SCOPe Domain Sequences for d1fdhh_:

Sequence; same for both SEQRES and ATOM records:

>d1fdhh_ a.1.1.2 (H:) Hemoglobin, beta-chain {Human fetus (Homo sapiens), gamma-chain [TaxId: 9606]}
ghfteedkatitslwgkvnvedaggetlgrllvvypwtqrffdsfgnlssasaimgnpkv
kahgkkvltslgdaikhlddlkgtfaqlselhcdklhvdpenfkllgnvlvtvlaihfgk
eftpevqaswqkmvtgvasalssryh

Timeline for d1fdhh_:

• d1fdhh_ first appeared in SCOP 1.73
  
• d1fdhh_ appears in SCOPe 2.05
  
• d1fdhh_ appears in SCOPe 2.07
  
• d1fdhh_ appears in the current release, SCOPe 2.08