![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
![]() | Superfamily a.60.4: Rad51 N-terminal domain-like [47794] (4 families) ![]() contains one classic and one pseudo HhH motifs |
![]() | Family a.60.4.1: DNA repair protein Rad51, N-terminal domain [47795] (1 protein) |
![]() | Protein DNA repair protein Rad51, N-terminal domain [47796] (7 species) |
![]() | Species Methanococcus voltae [TaxId:2188] [109872] (11 PDB entries) Uniprot O73948 |
![]() | Domain d1xu4a1: 1xu4 A:5-64 [116045] Other proteins in same PDB: d1xu4a2 complexed with anp, k, mg |
PDB Entry: 1xu4 (more details), 2.4 Å
SCOPe Domain Sequences for d1xu4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xu4a1 a.60.4.1 (A:5-64) DNA repair protein Rad51, N-terminal domain {Methanococcus voltae [TaxId: 2188]} ltdlpgvgpstaeklveagyidfmkiatatvgeltdiegisekaaakmimgardlcdlgf
Timeline for d1xu4a1: