SCOP 1.71: Domain d1xu4a1: 1xu4 A:5-64

Lineage for d1xu4a1 (1xu4 A:5-64)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.60: SAM domain-like [47768] (14 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.4: Rad51 N-terminal domain-like [47794] (3 families)
   contains one classic and one pseudo HhH motifs

5. Family a.60.4.1: DNA repair protein Rad51, N-terminal domain [47795] (1 protein)

6. Protein DNA repair protein Rad51, N-terminal domain [47796] (4 species)

7. Species Archaeon Methanococcus voltae [TaxId:2188] [109872] (2 PDB entries)

8. Domain d1xu4a1: 1xu4 A:5-64 [116045]
   Other proteins in same PDB: d1xu4a2
   complexed with anp, k, mg; mutant

Details for d1xu4a1

PDB Entry: 1xu4, 2.4 Å

PDB Description: atpase in complex with amp-pnp, magnesium and potassium co-f

SCOP Domain Sequences for d1xu4a1:

Sequence; same for both SEQRES and ATOM records:

>d1xu4a1 a.60.4.1 (A:5-64) DNA repair protein Rad51, N-terminal domain {Archaeon Methanococcus voltae}
ltdlpgvgpstaeklveagyidfmkiatatvgeltdiegisekaaakmimgardlcdlgf

Timeline for d1xu4a1:

• d1xu4a1 is new in SCOP 1.71
  
• d1xu4a1 appears in SCOP 1.73
  
• d1xu4a1 appears in the current release, SCOPe 2.08