Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.28: Ribosomal protein S19 [54569] (1 superfamily) alpha-beta-X-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 123 |
Superfamily d.28.1: Ribosomal protein S19 [54570] (1 family) |
Family d.28.1.1: Ribosomal protein S19 [54571] (1 protein) |
Protein Ribosomal protein S19 [54572] (1 species) |
Species Thermus thermophilus [TaxId:274] [54573] (38 PDB entries) |
Domain d1xnqs_: 1xnq S: [115622] Other proteins in same PDB: d1xnqb_, d1xnqc1, d1xnqc2, d1xnqd_, d1xnqe1, d1xnqe2, d1xnqf_, d1xnqg_, d1xnqh_, d1xnqi_, d1xnqj_, d1xnqk_, d1xnql_, d1xnqm_, d1xnqn_, d1xnqo_, d1xnqp_, d1xnqq_, d1xnqr_, d1xnqt_, d1xnqv_ complexed with mg, par, zn |
PDB Entry: 1xnq (more details), 3.05 Å
SCOP Domain Sequences for d1xnqs_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xnqs_ d.28.1.1 (S:) Ribosomal protein S19 {Thermus thermophilus [TaxId: 274]} prslkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpvy itenmvghklgefaptrtyr
Timeline for d1xnqs_: