SCOP 1.73: Domain d1xnql_: 1xnq L:

Lineage for d1xnql_ (1xnq L:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.40: OB-fold [50198] (12 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (14 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (22 proteins)
   barrel, closed; n=5, S=8

6. Protein Ribosomal protein S12 [50302] (1 species)

7. Species Thermus thermophilus [TaxId:274] [50303] (36 PDB entries)

8. Domain d1xnql_: 1xnq L: [115615]
   Other proteins in same PDB: d1xnqb_, d1xnqc1, d1xnqc2, d1xnqd_, d1xnqe1, d1xnqe2, d1xnqf_, d1xnqg_, d1xnqh_, d1xnqi_, d1xnqj_, d1xnqk_, d1xnqm_, d1xnqn_, d1xnqo_, d1xnqp_, d1xnqq_, d1xnqr_, d1xnqs_, d1xnqt_, d1xnqv_
   complexed with mg, par, zn

Details for d1xnql_

PDB Entry: 1xnq, 3.05 Å

PDB Description: Structure of an Inosine-Adenine Wobble Base Pair Complex in the Context of the Decoding Center

PDB Compounds: (L:) ribosomal protein s12

SCOP Domain Sequences for d1xnql_:

Sequence; same for both SEQRES and ATOM records:

>d1xnql_ b.40.4.5 (L:) Ribosomal protein S12 {Thermus thermophilus [TaxId: 274]}
ptinqlvrkgrekvrkkskvpalkgapfrrgvctvvrtvtpkkpnsalrkvakvrltsgy
evtayipgeghnlqehsvvlirggrvkdlpgvryhivrgvydaagvkdrkksrskygtkk
pkea

Timeline for d1xnql_:

• d1xnql_ first appeared in SCOP 1.71
  
• d1xnql_ appears in SCOP 1.75
  
• d1xnql_ appears in the current release, SCOPe 2.08