SCOP 1.73: Domain d1xnqn_: 1xnq N:

Lineage for d1xnqn_ (1xnq N:)

1. Root: SCOP 1.73

2. Class g: Small proteins [56992] (85 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (15 families)

5. Family g.39.1.7: Ribosomal protein S14 [57752] (1 protein)

6. Protein Ribosomal protein S14 [57753] (1 species)

7. Species Thermus thermophilus [TaxId:274] [57754] (36 PDB entries)

8. Domain d1xnqn_: 1xnq N: [115617]
   Other proteins in same PDB: d1xnqb_, d1xnqc1, d1xnqc2, d1xnqd_, d1xnqe1, d1xnqe2, d1xnqf_, d1xnqg_, d1xnqh_, d1xnqi_, d1xnqj_, d1xnqk_, d1xnql_, d1xnqm_, d1xnqo_, d1xnqp_, d1xnqq_, d1xnqr_, d1xnqs_, d1xnqt_, d1xnqv_
   complexed with mg, par, zn

Details for d1xnqn_

PDB Entry: 1xnq, 3.05 Å

PDB Description: Structure of an Inosine-Adenine Wobble Base Pair Complex in the Context of the Decoding Center

PDB Compounds: (N:) ribosomal protein s14

SCOP Domain Sequences for d1xnqn_:

Sequence; same for both SEQRES and ATOM records:

>d1xnqn_ g.39.1.7 (N:) Ribosomal protein S14 {Thermus thermophilus [TaxId: 274]}
arkaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkasw

Timeline for d1xnqn_:

• d1xnqn_ first appeared in SCOP 1.71
  
• d1xnqn_ appears in SCOP 1.75
  
• d1xnqn_ appears in the current release, SCOPe 2.08