Lineage for d1xfea1 (1xfe A:45-83)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1960255Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1961206Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 1961207Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 1961503Protein Low density lipoprotein (LDL) receptor, different EGF domains [64539] (1 species)
  7. 1961504Species Human (Homo sapiens) [TaxId:9606] [64540] (7 PDB entries)
    Uniprot P01130 272-353
  8. 1961514Domain d1xfea1: 1xfe A:45-83 [115259]
    Other proteins in same PDB: d1xfea2
    complexed with ca

Details for d1xfea1

PDB Entry: 1xfe (more details)

PDB Description: solution structure of the la7-egfa pair from the ldl receptor
PDB Compounds: (A:) low-density lipoprotein receptor

SCOPe Domain Sequences for d1xfea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xfea1 g.3.11.1 (A:45-83) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]}
tnecldnnggcshvcndlkigyeclcpdgfqlvaqrrce

SCOPe Domain Coordinates for d1xfea1:

Click to download the PDB-style file with coordinates for d1xfea1.
(The format of our PDB-style files is described here.)

Timeline for d1xfea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xfea2