Lineage for d1wm3a_ (1wm3 A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1892544Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1892545Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1892546Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 1892759Protein SUMO-2 [117816] (1 species)
  7. 1892760Species Human (Homo sapiens) [TaxId:9606] [117817] (9 PDB entries)
    Uniprot P61956
  8. 1892761Domain d1wm3a_: 1wm3 A: [114736]

Details for d1wm3a_

PDB Entry: 1wm3 (more details), 1.2 Å

PDB Description: Crystal structure of human SUMO-2 protein
PDB Compounds: (A:) Ubiquitin-like protein SMT3B

SCOPe Domain Sequences for d1wm3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wm3a_ d.15.1.1 (A:) SUMO-2 {Human (Homo sapiens) [TaxId: 9606]}
hinlkvagqdgsvvqfkikrhtplsklmkaycerqglsmrqirfrfdgqpinetdtpaql
emededtidvfq

SCOPe Domain Coordinates for d1wm3a_:

Click to download the PDB-style file with coordinates for d1wm3a_.
(The format of our PDB-style files is described here.)

Timeline for d1wm3a_: