Lineage for d1wh3a_ (1wh3 A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1017615Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1017616Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1017617Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 1017621Protein 2'-5'-oligoadenylate synthetase-like protein, OASL [117808] (1 species)
  7. 1017622Species Human (Homo sapiens) [TaxId:9606] [117809] (1 PDB entry)
    Uniprot Q15646 434-507
  8. 1017623Domain d1wh3a_: 1wh3 A: [114631]
    Structural genomics target

Details for d1wh3a_

PDB Entry: 1wh3 (more details)

PDB Description: solution structure of c-terminal ubiquitin like domain of human 2'-5'- oligoadenylate synthetase-like protain (p59 oasl)
PDB Compounds: (A:) 59 kDa 2'-5'-oligoadenylate synthetase like protein

SCOPe Domain Sequences for d1wh3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wh3a_ d.15.1.1 (A:) 2'-5'-oligoadenylate synthetase-like protein, OASL {Human (Homo sapiens) [TaxId: 9606]}
gssgssgiqvfvknpdggsyayainpnsfilglkqqiedqqglpkkqqqlefqgqvlqdw
lglgiygiqdsdtlilskkkgsgpssg

SCOPe Domain Coordinates for d1wh3a_:

Click to download the PDB-style file with coordinates for d1wh3a_.
(The format of our PDB-style files is described here.)

Timeline for d1wh3a_: