Lineage for d1wh3a1 (1wh3 A:8-81)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2931198Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2931202Protein 2'-5'-oligoadenylate synthetase-like protein, OASL [117808] (1 species)
  7. 2931203Species Human (Homo sapiens) [TaxId:9606] [117809] (1 PDB entry)
    Uniprot Q15646 434-507
  8. 2931204Domain d1wh3a1: 1wh3 A:8-81 [114631]
    Other proteins in same PDB: d1wh3a2, d1wh3a3
    Structural genomics target

Details for d1wh3a1

PDB Entry: 1wh3 (more details)

PDB Description: solution structure of c-terminal ubiquitin like domain of human 2'-5'- oligoadenylate synthetase-like protain (p59 oasl)
PDB Compounds: (A:) 59 kDa 2'-5'-oligoadenylate synthetase like protein

SCOPe Domain Sequences for d1wh3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wh3a1 d.15.1.1 (A:8-81) 2'-5'-oligoadenylate synthetase-like protein, OASL {Human (Homo sapiens) [TaxId: 9606]}
iqvfvknpdggsyayainpnsfilglkqqiedqqglpkkqqqlefqgqvlqdwlglgiyg
iqdsdtlilskkkg

SCOPe Domain Coordinates for d1wh3a1:

Click to download the PDB-style file with coordinates for d1wh3a1.
(The format of our PDB-style files is described here.)

Timeline for d1wh3a1: