Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (45 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein Elongation factor SelB, N-terminal domain [117537] (1 species) |
Species Methanococcus maripaludis [TaxId:39152] [117538] (3 PDB entries) |
Domain d1wb1c4: 1wb1 C:1-179 [114446] Other proteins in same PDB: d1wb1a1, d1wb1a2, d1wb1a3, d1wb1b1, d1wb1b2, d1wb1c1, d1wb1c2, d1wb1c3, d1wb1d1, d1wb1d2 |
PDB Entry: 1wb1 (more details), 3 Å
SCOP Domain Sequences for d1wb1c4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wb1c4 c.37.1.8 (C:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis} mdfkninlgifghidhgkttlskvlteiastsahdklpesqkrgitidigfsafklenyr itlvdapghadliravvsaadiidlalivvdakegpktqtgehmlildhfnipiivvitk sdnagteeikrtemimksilqsthnlknssiipisaktgfgvdelknliittlnnaeii
Timeline for d1wb1c4: