![]() | Class b: All beta proteins [48724] (149 folds) |
![]() | Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies) barrel, closed; n=6, S=10; greek-key |
![]() | Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (1 family) ![]() probably related to the second domain and its superfamiy by a circular permutation |
![]() | Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (5 proteins) |
![]() | Protein Elongation factor SelB, domain 3 [117223] (1 species) |
![]() | Species Methanococcus maripaludis [TaxId:39152] [117224] (3 PDB entries) |
![]() | Domain d1wb1b2: 1wb1 B:272-387 [114441] Other proteins in same PDB: d1wb1a1, d1wb1a2, d1wb1a4, d1wb1b1, d1wb1b3, d1wb1c1, d1wb1c2, d1wb1c4, d1wb1d1, d1wb1d3 |
PDB Entry: 1wb1 (more details), 3 Å
SCOP Domain Sequences for d1wb1b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wb1b2 b.44.1.1 (B:272-387) Elongation factor SelB, domain 3 {Methanococcus maripaludis} klqtvdkivakikisdifkynltpkmkvhlnvgmlivpavavpfkkvtfgkteeniilne visgnecycafeleekvlaevgdrvlitrldlppttlricghglieefkpikdlni
Timeline for d1wb1b2: