| Class b: All beta proteins [48724] (149 folds) |
| Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.3: Translation proteins [50447] (3 families) ![]() |
| Family b.43.3.1: Elongation factors [50448] (9 proteins) |
| Protein Elongation factor SelB, domains 2 and 4 [117218] (1 species) EF-Tu homologue, contains extra C-terminal domain (domain 4) of the same fold as the postG domain 2 |
| Species Methanococcus maripaludis [TaxId:39152] [117219] (3 PDB entries) |
| Domain d1wb1d1: 1wb1 D:180-271 [114447] Other proteins in same PDB: d1wb1a3, d1wb1a4, d1wb1b2, d1wb1b3, d1wb1c3, d1wb1c4, d1wb1d2, d1wb1d3 complexed with cmh, dxc, gdp, mg, so4 |
PDB Entry: 1wb1 (more details), 3 Å
SCOP Domain Sequences for d1wb1d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wb1d1 b.43.3.1 (D:180-271) Elongation factor SelB, domains 2 and 4 {Methanococcus maripaludis}
rntesyfkmpldhafpikgagtvvtgtinkgivkvgdelkvlpinmstkvrsiqyfkesv
meakagdrvgmaiqgvdakqiyrgciltskdt
Timeline for d1wb1d1: